DPCfam | MC461691
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 330 ± 37 aa |
| Residues in low-complexity regions (%) | 2.02 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.39 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14885 |
| Sequences matching dominant architecture (%) | 94.7 |
| Average overlap percent | 80.24 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0F9N7V9 | 80-415 | 336 | RKSQIRTLRKMNGKIKIIRHFNAGHIFPNAPDYNYINKNHPDWFAKTSTGKRVRTSKTKAFVMEPSNPGYQKRIAAHARRFTQYG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NPQ1-F1 | 423-503 | 24.00 | 97.77 | View in AlphaFoldDB ↗ |