DPCfam | MC461643
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 98 ± 8 aa |
| Residues in low-complexity regions (%) | 1.61 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.58 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF00566 |
| Sequences matching dominant architecture (%) | 2.38 |
| Average overlap percent | 51.25 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00084BBCB7 | 583-697 | 115 | ITSFACHQVRENGYMIPSHLVLTQHGVLLVRCIEGKSKYGDIVASRSLSSIMKITSKKKHPDLITFKYGTTRADGEAVITDMDRF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6NRC7-F1 | 577-675 | 99.01 | 88.62 | View in AlphaFoldDB ↗ |