DPCfam | MC461454
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 87 ± 7 aa |
| Residues in low-complexity regions (%) | 1.13 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.59 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF16658 |
| Sequences matching dominant architecture (%) | 97.39 |
| Average overlap percent | 56.76 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E3EB90 | 438-522 | 85 | LLGVVGQLQFEVFEYRMKGEYGVDVQLQRMPFQFARWIVDEQIDPSKFRINSTLVKDKKGNYVALFENEYAMRTAIEKNPTAKFL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5N192-F1 | 456-543 | 97.78 | 89.40 | View in AlphaFoldDB ↗ |