DPCfam | MC461062
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 135 ± 15 aa |
| Residues in low-complexity regions (%) | 3.21 |
| Residues in coiled-coil regions (%) | 67.71 |
| Predicted disordered residues (%) | 29.19 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1R3GKJ9 | 899-1037 | 139 | LAGSLRREKMAETTVQKLEAEIEQMNRLICQREEDVQRIKMMLRFREEKIKNLDLLATGLVSTEEYLMEENRALKEEVRLLQTKI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A368UIH5-F1 | 228-366 | 98.58 | 66.41 | View in AlphaFoldDB ↗ |