DPCfam | MC460934
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 301 |
|---|---|
| Mean domain length (aa) | 269 ± 28 aa |
| Residues in low-complexity regions (%) | 1.83 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.98 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF00041 |
| Sequences matching dominant architecture (%) | 9.17 |
| Average overlap percent | 1.67 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1M7RCV8 | 13-304 | 292 | MLLCIICSPLAAQQYPVKVQVQTLQPVPAQISNLYNGSQARMIITLLNTDLQEATMNVRLRLNIKGTTVALRNRDYGSYPLVRLD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A140LGL5-F1 | 1030-1060 | 13.48 | 87.00 | View in AlphaFoldDB ↗ |