DPCfam | MC460459
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 5261 |
|---|---|
| Mean domain length (aa) | 135 ± 18 aa |
| Residues in low-complexity regions (%) | 2.05 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.04 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00754 |
| Sequences matching dominant architecture (%) | 82.1 |
| Average overlap percent | 85.1 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1G4G3Q0 | 237-374 | 138 | SATASSFQPGEGIEKSVDGDYSTIYHSNWNNSAPDYFPITIDYHFQDQESIDYLIYHPRTSGWNGHFKEVEIWASTQSDPAFEKM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R4IY57-F1 | 32-161 | 95.59 | 96.08 | View in AlphaFoldDB ↗ |