DPCfam | MC460175
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 129 ± 12 aa |
| Residues in low-complexity regions (%) | 6.82 |
| Residues in coiled-coil regions (%) | 0.2 |
| Predicted disordered residues (%) | 6.1 |
| Average transmembrane regions | 1.99 |
| Dominant Pfam architecture(s) | PF02361 |
| Sequences matching dominant architecture (%) | 80.52 |
| Average overlap percent | 19.05 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0M0G1W5 | 160-290 | 131 | QKLRGHDMFNGSVKKRSRTGMLYMQKLLTWSLEEALQTAESMNARGFGERKRSHYQLFPFRYSDWGASIVLAGIAGVCVYSAQNG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q50292-F1 | 315-407 | 67.65 | 86.21 | View in AlphaFoldDB ↗ |