DPCfam | MC459783
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 503 ± 59 aa |
| Residues in low-complexity regions (%) | 3.36 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 4.67 |
| Average transmembrane regions | 0.41 |
| Dominant Pfam architecture(s) | PF13385 |
| Sequences matching dominant architecture (%) | 3.28 |
| Average overlap percent | 14.67 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J4JDU6 | 363-911 | 549 | LFFINLLCELSNKIVISSNILMKMLNPIVFSPHITLFNYKEEYNTIFAFRKKIFSMILAEHQNVMPLFLSHFDSTPLLFAEFIGR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F4I9T0-F1 | 126-504 | 72.96 | 81.75 | View in AlphaFoldDB ↗ |