DPCfam | MC45920
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 87 ± 18 aa |
| Residues in low-complexity regions (%) | 3.86 |
| Residues in coiled-coil regions (%) | 68.54 |
| Predicted disordered residues (%) | 36.58 |
| Average transmembrane regions | 0.06 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G3IAW1 | 48-169 | 122 | AILVNNITTGERLIRELQECDFVVPCVSECHGSHTETSEVICRFGLDQLKALQRSYGILQQDIFQFQKNQSSMEMKFTYDLSRCV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8NBJ4-F1 | 106-196 | 98.91 | 87.35 | View in AlphaFoldDB ↗ |