DPCfam | MC45903
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 95 ± 9 aa |
| Residues in low-complexity regions (%) | 4.58 |
| Residues in coiled-coil regions (%) | 33.29 |
| Predicted disordered residues (%) | 26.04 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1S3NXK3 | 199-288 | 90 | AAQFFRKCHQAGCTQFIFSEFASRLNTITERISSQQASEEDFNLTLKVLEASGMLPEIFAKRDQEMEKRLKDLQRETESVRTARS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9UIL8-F1 | 212-305 | 98.95 | 91.26 | View in AlphaFoldDB ↗ |