DPCfam | MC458564
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 641 |
|---|---|
| Mean domain length (aa) | 118 ± 22 aa |
| Residues in low-complexity regions (%) | 6.21 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.0 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13827 |
| Sequences matching dominant architecture (%) | 97.39 |
| Average overlap percent | 81.39 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0Q8JFL5 | 42-188 | 147 | PRSANAAKTSCTTPSRPRDRKPVDQTRVARARIEWSDRWGAIATGRGNTFGVAFEKLSKHDAETTALAQCRGAVGGDCAIAQSYS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0F2P6-F1 | 6-113 | 97.41 | 89.62 | View in AlphaFoldDB ↗ |