DPCfam | MC458229
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 105 ± 9 aa |
| Residues in low-complexity regions (%) | 2.46 |
| Residues in coiled-coil regions (%) | 1.76 |
| Predicted disordered residues (%) | 10.29 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF17781 |
| Sequences matching dominant architecture (%) | 2.82 |
| Average overlap percent | 16.35 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1C7N297 | 5-112 | 108 | TSANGIIALLDEQQPELKVYALQQLNTLVDEFWAEISDSIAKIEILYEDTSFSQRELAALVASKVYYNLGELDDSLTFALGAGQS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A2R8Q718-F1 | 4-106 | 99.04 | 83.20 | View in AlphaFoldDB ↗ |