DPCfam | MC45821
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 160 ± 22 aa |
| Residues in low-complexity regions (%) | 3.48 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.31 |
| Average transmembrane regions | 0.98 |
| Dominant Pfam architecture(s) | PF13848 |
| Sequences matching dominant architecture (%) | 52.38 |
| Average overlap percent | 37.14 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1U7Q3D8 | 254-420 | 167 | KLVAIAVVDEKNTSVEHTRLKSVIQEVARDFRDHFHRDFQFGHMNGNDYINTLLMDELTVPTIVVLNTSNQQYFLLDRHIEDVSD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A044QWT0-F1 | 150-300 | 91.41 | 86.15 | View in AlphaFoldDB ↗ |