DPCfam | MC458118
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 741 |
|---|---|
| Mean domain length (aa) | 359 ± 40 aa |
| Residues in low-complexity regions (%) | 2.96 |
| Residues in coiled-coil regions (%) | 0.05 |
| Predicted disordered residues (%) | 17.98 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF07221 |
| Sequences matching dominant architecture (%) | 93.55 |
| Average overlap percent | 91.2 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1A2VDM8 | 139-650 | 512 | WLDDLFDARHDYTVTDFAALYQTNLNIVGQKADDDLQECATLSRLIYGLSSAYLLTGAERYFLAARAAVSYQRQAFRTLTSDGMH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F8WRK9-F1 | 23-396 | 100.00 | 97.05 | View in AlphaFoldDB ↗ |