DPCfam | MC458072
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 153 ± 13 aa |
| Residues in low-complexity regions (%) | 5.8 |
| Residues in coiled-coil regions (%) | 34.24 |
| Predicted disordered residues (%) | 39.02 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A195FBX6 | 348-500 | 153 | GERSGEQAKRYQIVAKEAQAVIPSNDLQALARNLSANATPRKPPRRLYVAPAPPEQIPMERISQIPTLRDELVPTGTSTLPLMED... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A3Q0KT18-F1 | 308-437 | 88.54 | 83.32 | View in AlphaFoldDB ↗ |