DPCfam | MC458027
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 153 ± 33 aa |
| Residues in low-complexity regions (%) | 4.08 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.71 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03020 |
| Sequences matching dominant architecture (%) | 93.55 |
| Average overlap percent | 22.91 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0005767D0E | 893-1107 | 215 | DYLYTDTEQGHELIETHVPPTSNTSLSSSLSTSSSEETVLYDWRSLQVAGGAAANAKENQQPATLAEWPGSKGLTDKELRRRLMD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1QR97-F1 | 668-804 | 95.92 | 82.50 | View in AlphaFoldDB ↗ |