DPCfam | MC458012
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 134 ± 13 aa |
| Residues in low-complexity regions (%) | 4.64 |
| Residues in coiled-coil regions (%) | 1.32 |
| Predicted disordered residues (%) | 12.15 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07653 |
| Sequences matching dominant architecture (%) | 5.41 |
| Average overlap percent | 12.38 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| S4RN90 | 4-133 | 130 | HTELMLRLTAAWKNSGELHEACQERLRDNLRLMESEPAELTALFHELSVRLLSIHSDSDSIAITFNTAEELGKFTNYYSLGLVSE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8TF17-F1 | 48-181 | 93.71 | 86.21 | View in AlphaFoldDB ↗ |