DPCfam | MC45786
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 254 ± 30 aa |
| Residues in low-complexity regions (%) | 3.37 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 35.14 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00092 |
| Sequences matching dominant architecture (%) | 81.63 |
| Average overlap percent | 30.47 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F3J439 | 152-407 | 256 | YAPSAGESAGSDVPSSGIAAGQLTAGEVNDFTKWKLWEDIKTTDLASYNTQWKLYPENRFVVQVSNKKKLPVHNATAVLMDELGN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7PWW5-F1 | 149-270 | 47.08 | 89.97 | View in AlphaFoldDB ↗ |