DPCfam | MC457738
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 560 ± 82 aa |
| Residues in low-complexity regions (%) | 6.4 |
| Residues in coiled-coil regions (%) | 0.09 |
| Predicted disordered residues (%) | 14.17 |
| Average transmembrane regions | 8.59 |
| Dominant Pfam architecture(s) | PF03733- PF01699 |
| Sequences matching dominant architecture (%) | 85.93 |
| Average overlap percent | 74.65 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A066WN46 | 696-1393 | 698 | HSSGDGEDTRSGGGDEDINPDDVEYTLKDRQDAINIEHPFGLPIWKPALYKKSRSVTRNAETALHSMPSAAAERHLLPGNILWTV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7PT80-F1 | 270-850 | 98.11 | 66.60 | View in AlphaFoldDB ↗ |