DPCfam | MC457473
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 458 ± 102 aa |
| Residues in low-complexity regions (%) | 5.02 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.56 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01426 |
| Sequences matching dominant architecture (%) | 45.16 |
| Average overlap percent | 23.23 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1X2IL07 | 10-371 | 362 | QIKLNDGTVVGINDHIYLSPEHLGEPYYIGRVMEFCKVPNRKGLQVRVANYSRPKDIFNLKSYDATLLIATMNSDLNPVSSIRGK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175W278-F1 | 304-799 | 100.00 | 81.38 | View in AlphaFoldDB ↗ |