DPCfam | MC457300
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 401 |
|---|---|
| Mean domain length (aa) | 250 ± 34 aa |
| Residues in low-complexity regions (%) | 2.61 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.2 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF09497 |
| Sequences matching dominant architecture (%) | 93.28 |
| Average overlap percent | 24.32 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0K6GCQ2 | 46-333 | 288 | LGYPGFDPPRPGQPEDILTEQNVKQGYTFVNNSLGNVSNDSFSAHGLIYGSLKPSRNRSALALLGDLMSAVYEVRAEASSSIPPN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q4P456-F1 | 54-396 | 97.50 | 61.25 | View in AlphaFoldDB ↗ |