DPCfam | MC4568
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 244 ± 26 aa |
| Residues in low-complexity regions (%) | 2.54 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.92 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| I9CMU9 | 18-260 | 243 | SIQIGGCANVVPSFDIPHMPSTSGSPVPTVSSIVRRIRCELIEIASPEGEDIDRLLIADRDIQAVIELSLSVTQDGKIAPSFSFP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P55521-F1 | 27-277 | 88.80 | 86.89 | View in AlphaFoldDB ↗ |