DPCfam | MC45664
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 94 ± 13 aa |
| Residues in low-complexity regions (%) | 4.7 |
| Residues in coiled-coil regions (%) | 0.47 |
| Predicted disordered residues (%) | 0.44 |
| Average transmembrane regions | 2.8 |
| Dominant Pfam architecture(s) | PF00211 |
| Sequences matching dominant architecture (%) | 1.67 |
| Average overlap percent | 51.31 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1S3J5F8 | 269-358 | 90 | YIKDVLIEAPARGCLERIRRCISLWYMRHVLGAVLTSLPAAAVYANFSCAQEEDQQKHAIFYCYLLLVALLHYCNFTMLSSWMKS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9DGG6-F1 | 831-922 | 97.89 | 85.69 | View in AlphaFoldDB ↗ |