DPCfam | MC45622
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 79 ± 4 aa |
| Residues in low-complexity regions (%) | 0.31 |
| Residues in coiled-coil regions (%) | 0.48 |
| Predicted disordered residues (%) | 20.6 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W1Q8H3 | 614-695 | 82 | EDVKPVPIYSTSTLRLVEVPYKFAELIKNSANPLPEVQQKMKEIFATGQRLTKYHVWYRLDGLKDELLAETLRFNLNRLEYI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P31376-F1 | 540-618 | 98.75 | 91.10 | View in AlphaFoldDB ↗ |