DPCfam | MC456179
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 116 ± 8 aa |
| Residues in low-complexity regions (%) | 2.8 |
| Residues in coiled-coil regions (%) | 2.67 |
| Predicted disordered residues (%) | 16.65 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0P5K158 | 289-408 | 120 | RHSSLETINTNVTVADEFVWVDSYNRLVELQQLPWSNHDVLRVIQNGRIKEHLERVSMETVPRLSYLLQRALVRIARETQRLARP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-M9PFY3-F1 | 549-665 | 98.35 | 78.16 | View in AlphaFoldDB ↗ |