DPCfam | MC455960
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 339 ± 52 aa |
| Residues in low-complexity regions (%) | 14.94 |
| Residues in coiled-coil regions (%) | 12.18 |
| Predicted disordered residues (%) | 49.97 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF07197 |
| Sequences matching dominant architecture (%) | 71.21 |
| Average overlap percent | 13.69 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| J3KUJ3 | 10-321 | 312 | IPFGSASQFRYGVCTLQEFDDWWVKIRQHLFTVPVGFYCNRINSNCTSSDSKNFTRPPSPPRKLKRKKLTSKPAAKKAKVAEAIP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0D707-F1 | 14-220 | 50.00 | 78.90 | View in AlphaFoldDB ↗ |