DPCfam | MC455797
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 94 ± 8 aa |
| Residues in low-complexity regions (%) | 3.9 |
| Residues in coiled-coil regions (%) | 12.2 |
| Predicted disordered residues (%) | 22.93 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04740 |
| Sequences matching dominant architecture (%) | 76.23 |
| Average overlap percent | 46.18 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q3EM48 | 3-100 | 98 | LNMYLGEVQSQTQSMNAICNATIQSMEQAIQSIDAFAIDTVLQGQTYSSAKAYLVQTFRPLAQGIICLCEELIRQNEAFPNDFQA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2G0I1-F1 | 1-100 | 100.00 | 79.57 | View in AlphaFoldDB ↗ |