DPCfam | MC455709
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 404 ± 97 aa |
| Residues in low-complexity regions (%) | 1.42 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.08 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF17297- PF00821 |
| Sequences matching dominant architecture (%) | 69.64 |
| Average overlap percent | 86.18 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A1C51F8 | 45-503 | 459 | ICDGSEEENKALLVQLEEQGLLKKLPKYHNCWLARTDRRTMYVIPFSMGPLGSPLAKIGVELTDSPYVVLSMRVMTRMGKSVLSQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q05893-F1 | 97-599 | 100.00 | 96.22 | View in AlphaFoldDB ↗ |