DPCfam | MC455430
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 66 ± 8 aa |
| Residues in low-complexity regions (%) | 2.38 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.78 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04313 |
| Sequences matching dominant architecture (%) | 80.95 |
| Average overlap percent | 21.75 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W5V084 | 7-82 | 76 | PFIQSEDWVVVSEFKEQKKEELYYQSEEDLENLFIEMLGEIGYEYAAHIKNSDELKKNLRKKLEELNKTIFSENEW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3H599-F1 | 7-72 | 98.51 | 87.45 | View in AlphaFoldDB ↗ |