DPCfam | MC454442
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 215 ± 14 aa |
| Residues in low-complexity regions (%) | 1.09 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.54 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00053 |
| Sequences matching dominant architecture (%) | 23.19 |
| Average overlap percent | 4.45 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1A7YEP7 | 550-780 | 231 | RCDHVESGFFFVALDYYTYEAEDAKLGPGVAVVPRPHHYDRSPTWTGIGLVSIPEGAFLEFSVDNIPDSMEYDILIRYEPQLPDQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P07942-F1 | 552-771 | 99.53 | 82.46 | View in AlphaFoldDB ↗ |