DPCfam | MC454404
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 133 ± 10 aa |
| Residues in low-complexity regions (%) | 0.37 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.73 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00910 |
| Sequences matching dominant architecture (%) | 17.05 |
| Average overlap percent | 73.11 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0L8I7L6 | 29-161 | 133 | RNSSWRKWQQELLDELQNEPDQRKIIWYSDPIGNSGKTYLSRYLQTLDGIRFENGRSLDIKFMYNGQRIVIFDLTRSQEQHINYE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B5YFX9-F1 | 9-60 | 36.76 | 66.28 | View in AlphaFoldDB ↗ |