DPCfam | MC4544
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 113 ± 11 aa |
| Residues in low-complexity regions (%) | 3.09 |
| Residues in coiled-coil regions (%) | 0.92 |
| Predicted disordered residues (%) | 16.22 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06702 |
| Sequences matching dominant architecture (%) | 94.67 |
| Average overlap percent | 57.25 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E4X6T5 | 413-527 | 115 | IGNADRHHYEVWADQPESMIILLDNAKSFGNPHHDELSILAPVAQCCLLRKSTFDRLVELKGGLMTKMLIEATRTDPISPILHKK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8IXL6-F1 | 454-570 | 99.15 | 98.19 | View in AlphaFoldDB ↗ |