DPCfam | MC453794
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 152 ± 15 aa |
| Residues in low-complexity regions (%) | 11.79 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 44.22 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12234 |
| Sequences matching dominant architecture (%) | 51.81 |
| Average overlap percent | 24.56 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00052921DC | 947-1105 | 159 | TISASGSTARDPKTFSKTETTDYIEIDSVPPLPLYALLAADDDSSHSSSEKSNNQSSQNKKDMPKDNYEDLFQNTVVSTDELVTF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A158Q409-F1 | 194-336 | 97.86 | 49.04 | View in AlphaFoldDB ↗ |