DPCfam | MC453611
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 159 ± 34 aa |
| Residues in low-complexity regions (%) | 31.68 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 32.1 |
| Average transmembrane regions | 2.12 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H5U640 | 321-448 | 128 | DEQDRKIRYRERQRVAIALLTLVVISIALGAFLGLIGWIATGITVVMLFAYLAYLRSAVRNEQRLRAQRAARVARQRRQDEERRR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0FCW4-F1 | 167-361 | 94.55 | 71.05 | View in AlphaFoldDB ↗ |