DPCfam | MC453236
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 73 ± 10 aa |
| Residues in low-complexity regions (%) | 0.96 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.0 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11130 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 29.6 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1V5DQT0 | 51-125 | 75 | KFSSYLPWRAYDKEKVFYYNVDETIGFLWECTPLAFAGEKTSFILEGLFRVGIPFGSIIQFILYSDEYIDEELQL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P18004-F1 | 38-111 | 98.67 | 95.52 | View in AlphaFoldDB ↗ |