DPCfam | MC453171
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 155 ± 14 aa |
| Residues in low-complexity regions (%) | 2.69 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 43.26 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00400 |
| Sequences matching dominant architecture (%) | 3.12 |
| Average overlap percent | 16.77 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A193GS52 | 462-577 | 116 | DGEFITQGDAEAVLEEDQKEFEKEHEFREDEYISSDQYSDHGASRWTPPDKSHVTLGSPGVHEDDCFDDRVSLGEFMRTRTEALG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8TEP8-F1 | 469-623 | 100.00 | 39.74 | View in AlphaFoldDB ↗ |