DPCfam | MC452977
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 351 |
|---|---|
| Mean domain length (aa) | 171 ± 17 aa |
| Residues in low-complexity regions (%) | 2.23 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.78 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1Q9TQY8 | 1-166 | 166 | MALDDDALLVPAVGTYYYHPTVGTEVPADPDNPETDGYVDLGHTALEAPFGINTEGGEQAVLGTWRNRQARSVNSPRVESFNFVV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D3ZZ80-F1 | 836-893 | 34.66 | 84.39 | View in AlphaFoldDB ↗ |