DPCfam | MC452488
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 179 ± 13 aa |
| Residues in low-complexity regions (%) | 13.44 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.31 |
| Average transmembrane regions | 3.38 |
| Dominant Pfam architecture(s) | PF12250- PF12249 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 35.09 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B1ZLM5 | 347-532 | 186 | MLEPTALGGLCLAGTVWIVAAAGRSAVARALGVVVACGYLWYLLSTVALAAGTTLLAFRIEPILTAALASGAVWAAADLLERLRR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8NTW4-F1 | 364-546 | 99.45 | 94.02 | View in AlphaFoldDB ↗ |