DPCfam | MC45206
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 249 ± 50 aa |
| Residues in low-complexity regions (%) | 10.86 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 42.8 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13695 |
| Sequences matching dominant architecture (%) | 82.76 |
| Average overlap percent | 31.39 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| U3IJB7 | 68-329 | 261 | PFPGTPTPLPSDYLDSCHRAHLKALLSQVSPGLTPRLRRANTREIGVQVNPRADAAVQCSLGPRTLPAGRPLSPAGLYARGRMAL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q86SH2-F1 | 70-424 | 99.29 | 56.30 | View in AlphaFoldDB ↗ |