DPCfam | MC451865
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 301 |
|---|---|
| Mean domain length (aa) | 105 ± 21 aa |
| Residues in low-complexity regions (%) | 2.29 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.41 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10844 |
| Sequences matching dominant architecture (%) | 85.65 |
| Average overlap percent | 89.94 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| M9LGW1 | 2-80 | 79 | LSDCIKKIAQSANDEAVPMKIMFGSVKNTSPLEVLVDNRFVVDDDMLIVPGGVTLQVGDRAILLRDAGGQQFLVMGRLG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P45933-F1 | 7-87 | 98.23 | 87.54 | View in AlphaFoldDB ↗ |