DPCfam | MC451776
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 451 |
|---|---|
| Mean domain length (aa) | 84 ± 7 aa |
| Residues in low-complexity regions (%) | 0.69 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.44 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00750 |
| Sequences matching dominant architecture (%) | 93.25 |
| Average overlap percent | 36.58 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000931E269 | 272-357 | 86 | MAAEGMTYEKDGALWFKTTKFGDDKDRVLIKSDGAYTYLTPDIANHMFKFYRGYSQLVNLWGGDHHSYVDRMYAAMEALGHKGEL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B7GMJ3-F1 | 279-362 | 98.82 | 96.79 | View in AlphaFoldDB ↗ |