DPCfam | MC451544
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1871 |
|---|---|
| Mean domain length (aa) | 136 ± 9 aa |
| Residues in low-complexity regions (%) | 1.6 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.32 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12781 |
| Sequences matching dominant architecture (%) | 95.66 |
| Average overlap percent | 62.23 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1D2MQV5 | 3581-3712 | 132 | YPLLVDPQSQGKAWIKAKEAKKNLLVTSLNHKYFRTHLEDSLSLGRPLLIEDVGEELDPVIDNVLEKNFIKSGSISKVIVGDKEC... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A5K4F755-F1 | 136-271 | 100.00 | 88.64 | View in AlphaFoldDB ↗ |