DPCfam | MC451310
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 231 |
|---|---|
| Mean domain length (aa) | 76 ± 7 aa |
| Residues in low-complexity regions (%) | 5.14 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 3.66 |
| Average transmembrane regions | 1.33 |
| Dominant Pfam architecture(s) | PF02233 |
| Sequences matching dominant architecture (%) | 98.17 |
| Average overlap percent | 23.2 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0A2E1E2 | 190-274 | 85 | SVLALIILSALFGWLLAIRVGGADMPITISLLNSFSGLAGAIAGMATGDLLLISIGGVVGASGLLLTQIMCRAMNRSLMSILLGT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5F6S5-F1 | 197-272 | 97.44 | 88.65 | View in AlphaFoldDB ↗ |