DPCfam | MC451297
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 95 ± 12 aa |
| Residues in low-complexity regions (%) | 2.92 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.78 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF17851 |
| Sequences matching dominant architecture (%) | 97.73 |
| Average overlap percent | 50.63 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F8X1N3 | 367-456 | 90 | VETIFEARNILSQRTEGPKCSGIISMDISNMKDGDIAGLGAYCAEPGLISVVMEGNKKYLVMTDRDQERARVDLSVDKVYLRMDC... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VPM5-F1 | 347-450 | 96.19 | 97.72 | View in AlphaFoldDB ↗ |