DPCfam | MC451287
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 72 ± 6 aa |
| Residues in low-complexity regions (%) | 1.05 |
| Residues in coiled-coil regions (%) | 0.48 |
| Predicted disordered residues (%) | 7.88 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0005ABD76E | 179-251 | 73 | GFSIEHAEEARVATRFTDVGALVGFLRAIPWQIPDFTVERYRDQLRALHDRVQLEGPITAQGHRFLIRARSPV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EYD3-F1 | 178-252 | 98.68 | 97.78 | View in AlphaFoldDB ↗ |