DPCfam | MC450913
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 80 ± 18 aa |
| Residues in low-complexity regions (%) | 12.09 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.12 |
| Average transmembrane regions | 0.75 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R8BYK6 | 75-184 | 110 | SSKSSFFGLPNVSTRSFFGLSRPSYYKRSPRPSFMSRTIKKVKRLLRDLVYYAKRHPVKVFMLVVMPLITGGALTALLARFGLRM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7Q2Q5-F1 | 116-191 | 96.20 | 73.37 | View in AlphaFoldDB ↗ |