DPCfam | MC450470
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 243 ± 26 aa |
| Residues in low-complexity regions (%) | 4.47 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.8 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14580 |
| Sequences matching dominant architecture (%) | 3.51 |
| Average overlap percent | 30.85 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0L0HS61 | 495-728 | 234 | GENGYIELTNGRLAIYGDAINMIDKIDPSSVHTVRFTYVSFPKIAHFLLKLRRFTNLHTVAFSNNNLTRLKQINHLALLPEVSHL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9VZ81-F1 | 1022-1297 | 98.87 | 75.25 | View in AlphaFoldDB ↗ |