DPCfam | MC450001
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 332 ± 30 aa |
| Residues in low-complexity regions (%) | 7.05 |
| Residues in coiled-coil regions (%) | 0.41 |
| Predicted disordered residues (%) | 10.81 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B6KTI0 | 9-321 | 313 | LTALLAHSPPATQTALQCGLLDSVISALRQVHLSLLVQTSSTDKLKKNNPLVSEMVSYLTLLTSFLYGSDSVKSAAAQLGLADTV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q86VV8-F1 | 1864-2193 | 99.40 | 80.12 | View in AlphaFoldDB ↗ |