DPCfam | MC449947
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 149 ± 8 aa |
| Residues in low-complexity regions (%) | 0.62 |
| Residues in coiled-coil regions (%) | 10.58 |
| Predicted disordered residues (%) | 15.67 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08385 |
| Sequences matching dominant architecture (%) | 89.89 |
| Average overlap percent | 3.41 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A182M2Z6 | 749-898 | 150 | ERKLEPLRSKLTWEEDLSEFIEGYVVNVRELLDLIELYKRENHKISTLVERIYAMIFVRFEQQHPVNMAQLMNSVAEQKKAVFTE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A1ZAD3-F1 | 764-910 | 99.33 | 85.80 | View in AlphaFoldDB ↗ |