DPCfam | MC44993
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 94 ± 10 aa |
| Residues in low-complexity regions (%) | 3.57 |
| Residues in coiled-coil regions (%) | 45.2 |
| Predicted disordered residues (%) | 15.15 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05055 |
| Sequences matching dominant architecture (%) | 75.4 |
| Average overlap percent | 41.71 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00053C170B | 222-317 | 96 | GTQLDIAAKGMFILINDFDTLSRLVGRLYDEIEHRKTVAAMCVKSQKPEVLMEAVKEFDSHEQRFSEQLKELEEHVYLCSHTINR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1LDF4-F1 | 260-352 | 96.88 | 92.20 | View in AlphaFoldDB ↗ |